PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g086640.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 259aa    MW: 29316.2 Da    PI: 8.7963
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g086640.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.65.6e-101511881954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  Sopim10g086640.0.1 151 FEHflHPYPTDSDKVMLAKQTGLSRNQVSNWFINARVR 188
                         664459******************************87 PP

2BELL94.21.2e-3041111272
                BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         ++e+ +  +kL+s+l+eV++rYk y+eqlq v+ssFe vag+g+a p+++l lka+S+hFrcL  ai++q+
  Sopim10g086640.0.1  41 NHEHMRNNSKLISMLDEVHRRYKEYYEQLQGVVSSFESVAGVGNASPFANLSLKALSKHFRCLIKAICDQM 111
                         57888999************************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-136109IPR006563POX domain
PfamPF075267.0E-2733107IPR006563POX domain
PROSITE profilePS5007111.985129192IPR001356Homeobox domain
SMARTSM003896.4E-10132196IPR001356Homeobox domain
CDDcd000869.74E-13132193No hitNo description
SuperFamilySSF466891.28E-17134200IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-28135196IPR009057Homeodomain-like
PfamPF059203.5E-19149188IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MSHNKAEEIS LELMQDISGI YAHKLLQDHH HSLGTMDEVS NHEHMRNNSK LISMLDEVHR  60
RYKEYYEQLQ GVVSSFESVA GVGNASPFAN LSLKALSKHF RCLIKAICDQ MKSCDGIGKG  120
NYNNLERGGY VWRPQRGLPE RAVTVLRAWL FEHFLHPYPT DSDKVMLAKQ TGLSRNQVSN  180
WFINARVRVW KPMVEEIHML ETNKSSSHIN NNDPEMNLSS SGGVSLTLGL HHQNNNKALS  240
FPRNAARRFG IDPNNIIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A4e-17138196563Homeobox protein Meis2
4xrm_B4e-17138196563Homeobox protein Meis2
5bng_A4e-17138196159Homeobox protein Meis2
5bng_B4e-17138196159Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755221e-167HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010312363.10.0PREDICTED: BEL1-like homeodomain protein 9 isoform X3
RefseqXP_004249839.10.0PREDICTED: BEL1-like homeodomain protein 9 isoform X2
RefseqXP_010312362.10.0PREDICTED: BEL1-like homeodomain protein 9 isoform X1
SwissprotQ9LZM81e-72BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLK4D4950.0K4D495_SOLLC; Uncharacterized protein
STRINGSolyc10g086640.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-73TALE family protein